| Radius | 5 miles | 10 miles | 20 miles | 30 miles | 50 miles |
|---|
| Location | Title | Company | Pay | Date |
|---|---|---|---|---|
|
|
||||
|
US FL Tampa |
START ASAP**EVENT/RETAIL MARKETING FIRM-Entry Level |
SOUTH SIDE ASSOCIATES | 7/29 | |
| Details: START ASAP**EVENT/RETAIL MARKETING FIRM!!  Entry-Level Position!!!   South Side Associates handles in-store, retail marketing programs for our top clients in the Fashion and Cosmetic Industry.  Given the recent expansion of programs into surrounding cities, South Side Associates is looking to fill 8 full-time entry-level positions for Brand Representative in the Tampa area.   Our Brand Representatives execute retail marketing programs in major retail facilities throughout the Tampa area.  This includes (but is not limited to): - setting up event kiosks - handling supplies, inventory, and samples - product demonstrations - customer service - basic sales and promotions - maintaining relationships with our retail partners.    Full training, classroom style and hands-on, will be provided for all new employees. The ideal applicant will have some prior experience working with the public.  Retail, sales/marketing, or customer service experience is preferred, but not required.  Must be outgoing and be able to communicate and present yourself professionally.    The interview process will begin immediately.  The first step of the process for selected candidates will be a basic informational phone screening.  Unfortunately, we will not be able to contact everyone that applies.  All applicants will be reviewed on a first-come, first-serve basis. Priority will be given to those with immediate availability!!!   This is an opportunity for an entry level person to gain firsthand experience marketing a product line in a professional environment.  Once training is complete, our Brand Reps take full responsibility for ensuring success of our retail events assigned to them.  This is an opportunity for new professionals to learn to think on their feet, problem solve, and gain leadership experience.    Growth potential is based on performance and merit, not seniority!!    When emailing resume, NO attachments will be opened.  Please copy/paste your resume directly into the body of the e-mail. | ||||
|
|
||||
|
US FL Tampa |
Marketing Firms Seeks 7-10 Individuals |
PRECISION | 7/29 | |
| Details: Marketing Firms Seeks 7-10 IndividualsMarketing/Advertising/Sales PRECISION is now offering an opportunity for career minded individuals that are looking for unlimited growth potential. We are a Sales, Marketing and Management firm specializing in business development for our high profile clients. We are looking for individuals that have a passion for sales, marketing and motivating others; those people that are hard working and open minded.PRECISION specializes in developing cost effective strategies yielding our clients exceptional results. Our individuals get hands on experience dealing with our clients. We offer a unique and fun approach towards a successful business career. We are a company on the move – always striving to reach higher goals.  Our Company Offers:  Growth and Advancement Opportunities Strong Team Environment Pay Based Upon Performance A Long Term Career Opportunity A Fun and Challenging Corporate Culture | ||||
|
|
||||
|
US FL Oldsmar |
Business Development & Marketing Manager |
Tandel Systems | 7/29 | |
| Details: About the Company:Tandel Systems, Inc. is located in Oldsmar, FL and has provided engineering services and solutions in the Aerospace, Defense, Commercial Aviation and Government markets since 2001. Tandel Systems is looking for a Business Development & Marketing Manager to grow and expand its customer base by developing new business avenues and communicating effectively to customers and business partners through marketing initiatives.Business Development & Marketing Manager:·        Help the company grow and expand by reaching new customers·        Responsible for developing new business avenues for the company·        Work closely with the customer in developing proposals, building           relationships and responding to requirements·        Proficient in producing company collateral, campaigns, programs          and advertisements from conception to execution to effectively          represent the company's products and services to customers and prospects·        Provide market research for business development activities·        Manage strategic approach and develop win and team strategies          for proposals and business development initiatives·        Provide copywriting, research and supporting graphics for proposals·        Coordinate all corporate events such as trade shows and client          events by providing budget, schedule, plan, and support services          such as staffing the booth·        Manage the pipeline of opportunities in CRM to track revenues,          timelines, and activities·        Ability to work closely and effectively with other departments including          marketing, engineering, accounting to develop proposals, past          performances and white papers, presentations, meetings, etc.·        Ability to work under deadline pressure and extra hours if needed on          assignments | ||||
|
|
||||
|
US FL Tampa |
MARKETING-EVENTS/SALES/ADVERTISING ACCOUNT EXECUTIVES |
SOUTH SIDE | 7/27 | |
| Details: MARKETING POSITIONS-EVENTS / SALES / ADVERTISING ACCOUNT EXECUTIVES SALES/ADVERTISING/CUSTOMER SERVICESTART ASAP GROWTH AND EXPANSIONFOCUSING ON SUCCESS THROUGH ECONOMIC HARD TIMES___________________________________________________________ SOUTH SIDE continues to excel despite a struggling economy, named as one of the nations most competitive marketing and advertising firms in the area. Why do we continue to challenge the economic trend? OUR FOCUSOUR MENTALITYOUR HUNGER FOR SUCCESS We focus on finding an individuals niche, that inner strength that drives them to succeed. Our brand new events marketing and advertising division opened up a side of our company,never available before. We are looking to fill these positions immediately.  The methods we use are both personal and powerful, providing us with an upstanding image in the marketplace. Our methods have allowed us to reach 95% of our clients target market, providing them with at least 40% new customer acquisition. Our ability to go straight to the target market is our trademark and what has earned us our place as one of the nations leading marketing firms.  Cutting-edge insight; Driven Leaders; Innovative Strategies. You are what you preach. We see a tremendous amount of growth in 2010, following our expansion last year. We are looking for energetic and dynamic individuals to fill our positions immediately. Our company provides a mentorship program, therefore no experience is necessary. Contact our HR Manager by submitting a resume to  BUILDING STRONG BUSINESS PARTNERS OPPORTUNITY IS JUST AROUND THE CORNER SOUTH SIDE | ||||
|
|
||||
|
US FL Saint Petersburg |
Sr. Marketing Writer |
Raymond James Financial | 7/26 | |
| Details: Job Summary: Under limited supervision, uses specialized knowledge and skills obtained through education and experience to brainstorm, research, develop, write and execute materials and campaigns designed for retail investors. Develops and writes for marketing communication including advertising, brochures, collateral, and website contents. Limited guidance is provided to perform varied complex activities that require analytical ability, creativity, originality and ingenuity in making decisions and solving problems. Regular contact with internal customers is required to obtain, clarify and provide information.  Essential Duties and Responsibilities: Writes articles, brochures, ads, press releases, and other related informative, marketing and promotional materials. Writes to customers in their terms and on their level so that the message is more readily received. Coordinates multiple copy projects simultaneously. Develops and creates original concepts, writes, proofreads and edits copy for product information materials. Develops advertising campaigns for retail investors, works with the creative director and determines the best way to present marketing information. Builds editorial support for marketing ideas and projects. Establishes and continually updates writing standards to improve quality, user satisfaction and positively affect product management results. Establishes and track standards for efficiency and output quality. Interacts with product managers, marketing, sales, technology and other groups, as needed. Proofreads and ensures that copy is accurate, clearly written and adheres to all style, corporate and brand standards prior to being released for review, layout or publication. Partners with account managers and creative teams to research and assess competitor and market trends, translating business intent into creative strategies and executions. Adheres to compliance guidelines. Takes and active role in developing clear and differentiated branding positions. | ||||
|
|
||||
|
US FL tampa bay |
Sr. Marketing Associate |
America II Corp | 7/26 | |
| Details: America II Corp of St. Pete, is searching for an additional member to complement their team. Ideal candidate will possess a well-rounded marketing background to include; collateral design, trade show experience marketing program implementation and marketing research. Must have 5 years marketing experience and trade show coordination plus be able to travel and attend periodic trade shows. We offer a complete benefit package including: medical, vision, dental, 401(k) with 50% company match, paid vacation and personal days all in a casual, fun environment.   Learn more and apply on-line @ www.americaii.com or fax resume (with salary history) to: (727) 571-2039 eoe/dfw ONLY LOCAL CANDIDATES WILL BE CONSIDERED FOR THIS POSITION. | ||||
|
|
||||
|
US FL Tampa |
AVP - Marketing Services |
10% Fee | $100,000 - $120,000/Year | 7/26 |
| Details: Job TitleAVP - Marketing ServicesJob Function and Key Duties & ResponsibilitiesLead all business-unit planning and forecasting. Work collaboratively with business unit channel managers to create new strategic ideas, oversee the testing and analytic process, and manage implementation of key initiatives. Establish sales and cost projections for strategic initiatives, and develop comprehensive forecasting tools to analyze results. Create regular sales and cost updates for senior management with an emphasis on measuring performance against historical trends. Lead the annual planning process, establishing sales plans and cost forecasts for the business units. Make recommendations to maximum sales and cost management to efficiently grow the business and meet profitability targets. Manage marketing database used to support marketing and research activities. Provide support and oversight in direct mail modeling activities. -Develop plans for the implementation of strategic initiatives to continually maintain and improve sales results.-Collaborate with channel managers to develop new sales programs and channel enhancements based on AARP file statistics, market research, past campaign results, and NYL senior management/AFI input.-Lead the review of sales and cost performance for all channels in the business units.-Oversee implementation of best practices for creating proper tests and reading test results in timely and accurate manner.-Develop multiple sales and forecasting models to support the annual planning process.-Leverage historical response and sales data to project future trends.-Develop quality control processes that validate the accuracy and reasonableness of marketing plans and sales projections across all key measures.-Provide support and oversight for modeling activities, helping to coordinate marketing, research and outside vendors.-Facilitate marketing research activities as needed to support sales objectives.-Work with AARP/AFI on data-related issues that affect mail programs and marketing database. Must have complete knowledge of Marketing database and its components.-Work with Marketing staff to maximize marketing effectiveness within established profitability thresholds.-Help ensure compliance with legal, regulatory and NYL/AARP standards/requirements.-Oversee continuous review of process improvements in quality control, database activities, etc. | ||||
|
|
||||
|
US FL Oldsmar |
Sales and Marketing Professional |
Aflac | 7/26 | |
| Details: AFLAC SALES INSURANCE ASSOCIATE For 50 years, Aflac products have given policyholders the opportunity to direct cash benefits where they are needed most when a life-interrupting medical event causes financial challenges. Aflac is the number one provider of guaranteed-renewable insurance in the United States and the number one insurance company in terms of individual insurance policies in force in Japan. Aflac’s insurance products provide protection to more than 40 million people worldwide. In January 2008, Aflac was included in Fortune magazine’s list of the 100 Best Companies to Work For in America for the tenth consecutive year. Aflac has also been included on both Forbes magazine’s Platinum 400 List of America’s Best Big Companies and on Fortune magazine’s list of America’s Most Admired Companies. Aflac Incorporated is a Fortune 500 company listed on the New York Stock Exchange under the symbol (AFL). We are looking for enthusiastic, career minded, self-motivated individuals for the Insurance Sales Associate position to work in a professional business-to-business sales environment. Extensive management opportunities are available. Prior sales experience is welcome, but not necessary. If you are looking for a career with a top company, that still lets you be your own boss, do not pass this one by. Here’s How We Support Our Associates: Brand awareness/advertising campaign Associate customer service toll-free numbers Professional orientation, training, and certifications Professional field marketing materials The latest in sales automation technology Aflac Sales Associates enjoy these benefits: Aflac’s stock bonus program allows career associates to participate in the company’s growth, profitability and success as a stockholder. Aflac’s Associate Bonus Club (ABC) rewards associates for recruiting new members to the field force. Aflac associates have the opportunity to join the National Association of Professional Agents (NAPA). | ||||
|
|
||||
|
US FL Oldsmar |
Neighborhood Marketing Sales Representative |
TruGreen | 7/24 | |
| Details: Grow trust.At TruGreen, we do more than just care for lawns. We give our customers peace of mind. And, we provide our associates with challenging work and opportunities for growth.  We are currently seeking: Sales RepresentativesYour competitive spirit will come into play as you drive sales revenue by adding new customers and increasing sales to existing customers. Whether on the phone or at the customer’s home, you’ll deliver the service that brings in the business.  If you are self-motivated, energetic and persuasive, we will provide you the training to lead you on the path to a successful career. You must have strong customer relations, time management and communication skills. Sales Representatives enjoy:·        Lucrative, Limitless Commission Plan + Base Salary·        First year representatives typically make $40,000-$45,000·        Paid Training, Holidays and Vacation·        Rapid Career Advancement  The ideal Candidate will be able to show us:·        A high level of integrity·        A quick-thinking, problem-solving attitude·        1+ years sales experience (preferred) At TruGreen, you’ll enjoy a competitive compensation and benefits package, as well as the opportunity for professional growth and respect that comes from working for the industry leader. Come grow with us. AA/EOE M/F/V/D | ||||
|
|
||||
|
US FL Pinellas Park |
Sr. Marketing Specialist - ECP Communications |
Transitions | 7/23 | |
| Details: Are you interested in working for an innovative, successful and high-growth global company that recently received the Gallup Great Workplace Award - making it one of the most productive and engaged workplaces in the world? If so, then we would like you to consider joining our team.  Transitions Optical, the leading provider of photochromic ophthalmic lenses, is seeking a talented individual for a Sr. Marketing Specialist opportunity at our Pinellas Park, Florida location. The Senior Marketing Specialist contributes to the achievement of Transitions' marketing objectives by creating and implementing programs that reach as many eyecare professionals (ECPs) as possible through non-traditional ways, and have them positively and correctly recommend Transitions lenses. The position has responsibilities developing ECP communication programs and materials, overseeing CRM marketing, and managing digital communications directed toward ECPs. Responsibilities:     * Drives the overall strategy of the US trade portal website (Transitions.com/Pro)         o Continually monitor, update and expand the site.         o Provide monthly analytics of trade portal activity.         o Oversee activities to drive traffic     * Develops social media strategy as it applies to ECPs including management of        www.facebook.com/transitionsoptical     * Oversees independent eyecare professional CRM strategy utilizing segmentation profiles and classification of practices.        o Develops messaging plans to communicate regularly and effectively         o Builds tools to support practices    * Partners with other marketing functions to create digital extensions around marketing programs    * Responsible for ECP referral process and implementation     * Manages on-line content/processes for new ECP Engagement program including website and tracking     * Oversees ECP marketing budget on above projects    * Oversees agencies in implementation of above projects | ||||
|
|
||||
|
US FL Tampa |
Entry Level - Marketing - No nights or weekends |
A.M.I. | 7/23 | |
| Details: AMI is hiring for entry level sales and marketing positions. We have recently expanded in the Tampa Bay area! AMI., likes to keep things small… but in a big way.  We give our employees more attention, support and training, they are better able to service our clients and success is created. We are looking for accounts managers to work in our Marketing Department. This is an entry level position so we will train you to be an account manager for a Fortune 500 company. Successful candidates can grow into a management position. Candidates must have strong communication skills, student mentality, and leadership qualities!    Responsibilities in the Entry Level Include:  * Assisting in the daily operation of our company  * Assisting in new business acquisition and increasing market share  * Developing and implementing original training techniques to achieve internal goals  * Developing strong leadership skills to build a high performance, cross-functional team     environment  * Managing external customers' needs  * Developing excellent verbal, written, and presentation skills  * Face to face sales of services to new business prospects   One of the things AMI  takes pride in is the fact that we only promote to management positions from within. We are scheduled to open up three other locations in Tampa Bay by the end of 2010! If you want to learn how to run a marketing firm from the ground up apply now! | ||||
|
|
||||
|
US FL Tampa |
Marketing & Sales - Immediate Hire - Entry Level Position |
AMI | 7/23 | |
| Details: AMI is hiring for entry level sales and marketing positions.  Contact KIMBERLEE at  hr @ amitampa. com or for immediate consideration 813.289.6111 LEARN TO MANAGE A MARKETING FIRM FROM THE GROUND UP!!! AMI is currently hiring entry level individuals with a customer service or hospitality  background for the Account Manager position. This is an entry level position that involves new age entry level sales, marketing and customer service techniques followed by all the remaining topics necessary to train & develop you into becoming the manager of one of our marketing offices in the Tampa Bay area.Our marketing firm is the leader in the marketing industry and in tailoring customer service to their needs. Our clients are Fortune 500 companies. Our portfolio includes the most innovative telecommunications companies and the leading office supply company in the nation!  For more information on AMI check out our website at: http://www.amitampa.com/FULL TRAINING is PROVIDED! There is room for advancement in our organization and this is a full time position.If this sounds like you please contact KIMBERLEE at 813.289.6111 | ||||
|
|
||||
|
US FL Tampa |
SAS Marketing Campaign Data Analyst in Tampa Bay |
Sapphire Technologies U. S. | 7/22 | |
| Details: Sapphire Technologies is looking for a SAS Marketing Campaign Data Analyst with Marketing Automation (MA) experience for a permanent position in Tampa Bay. This position is responsible for enterprise-wide client campaign design, administration, report design and support of third party Customer Management and CRM software applications including, but not limited to: Unica’s Affinium Suite, MicroStrategy and SAS. The primary focus is utilizing advanced functions within our client’s CRM (Customer Relationship Management) tools to gain optimum Campaign efficiency and accuracy, and provide business owners with expertise to enhance business profitability. JOB RESPONSIBILITIES: Responsible for Customer Relationship Management (CRM) system integration Ensures all functions of CRM system effectively work with all other applications and operating systems Administers the Customer Relationship Management (CRM) applications Responsible for maintaining the CRM systems support and updating function Monitors end-user usage of systems and performs daily administrative tasks Assists Manager in tracking progress, prioritizing work, developing time estimates and work plans and assisting less experienced team members Provide Administration of CRM applications and software under the domain of Database Architecture to support enterprise-wide initiatives. Provide report development for one of the following: Unica Affinium Campaign Manager, SAS, or Cognos. Design recommendations to accommodate business requirements, application development needs, and database modifications required to implement CRM solutions.Provide leadership for other CRM team members and act as liaison between Administrators, Developers, Database Administrators, System Administrators, and business users Perform CRM Administration tasks including: - Perform CRM software installation and configuration - Perform CRM software backup and recovery - Apply CRM software patches and upgrades - Perform CRM performance tuning - Validate CRM source connectivity - Perform CRM scheduling tasks - Provide CRM documentation - Provide on-call support QUALIFICATIONS: EDUCATION: Bachelors’ degree or equivalent experience EXPERIENCE: Min 7 years of experience in the IT software development Min 3 years experience administering CRM products (SAS/Unica) Database background required Data modeling background required (minimum 3 years) Data warehouse familiarity (minimum 3 years)Sapphire Technologies is an EOE-M/F/V/D and is a wholly owned subsidiary of Randstad Holding nv, a $17.7 billion global provider of professional employment services and the second largest staffing organization in the world. | ||||
|
|
||||
|
US FL Tampa Bay |
Vice President Marketing / Chief Marketing Officer |
Global Recruiters Network | $80,000 - $120,000/Year | 7/22 |
| Details: CMO/Vice President of Marketing We havebeen retained by one of our best clients who is a rapidly growing technology andcloud services company to identify candidatesfor the role of Vice President of Marketing, reporting to theCEO. The CMO/Vice President of Marketingwill have had previous experience in B2B Technology organizations. Experiencewill include Marketing Communications, PR,Strategic Planning and Brand management preferably coming from the SMB spacewhere they have had to role up theirsleeves.  BA/BS in Marketingor related field. MBA a plus. Demonstrated experience working in B2B and Technology Marketing role is a must. Marketing / Sales / SEO / Business Analytics / Marketing Communications / Executive | ||||
|
|
||||
|
US FL Tampa |
Marketing Manager |
Club Assist | $65,000/Year | 7/21 |
| Details: Share our Values, Commit to our Vision, Join our Success! Our success in helping keep motorists on the go has caused rapid growth and created an opportunity for a Marketing Manager: Marketing ManagerAltamonte Springs, FL We are looking for an energetic, self-starter who has a strong marketing background and who is familiar with the automotive/service provider industry. If you are passionate about what you do and have a strong work ethic we’d like to meet you.Club Assist is an international mobile automobile battery provider contracted by AAA/CAA to provide its member clubs and service providers branded batteries, logistics, training, marketing and sales support for the AAA/CAA mobile Battery Service throughout the US and Canada. As the battery provider to the largest clubs around the globe, we provide product and support to over 70 automobile clubs  in the US, Canada, Australia, New Zealand, and Europe. Snapshot of what you’ll do: Working with the support of our US-based marketing and sales team, you’ll create and execute marketing campaigns, promotional/incentive programs, and events for North America’s most recognized motoring clubs, their members, and their roadside service providers. As Marketing Manager for Club Assist, you will have the opportunity to grow the already successful mobile Battery Service within the clubs in your territory.PURPOSE                                                                                                                 The purpose of the role is to create value for our partner clubs and service providers by developing and implementing effective marketing campaigns to increase member Battery Service usage and drive ROI. Strong planning and communication skills are critical to achieving this goal to ensure all clients and contributors are informed and involved in program/initiative execution. You will be working in our Altamonte Springs, FL office along side Sales and Operational teams and have a team of marketing peers and an in-house Graphics Department to support you.Above all, this is a strategically creative role where you will be tasked with developing solutions to operational and sales directives. By bringing new, innovative ideas, campaigns and marketing materials that help bring attention to program benefits, differentiators, championing service provider best practices, and much more. | ||||
|
|
||||
|
US FL Westshore |
Assistant Marketing Manager |
AAA Auto Club South | 7/21 | |
| Details: Assistant Marketing Manager AAA Auto Club South is looking for an Assistant Marketing Manager to join our Marketing team in Tampa. The selected candidate will be responsible for implementing strategic and tactical marketing plans for assigned product lines and local area markets to help ensure that sales, growth, profitability and customer satisfaction goals are achieved. Primary responsibilities will be:  Manage integrated marketing campaigns and tactics from development to execution in a fast-paced, deadline-driven environment Stay within allotted budget, implement one-year tactical plans to achieve marketing goals, monitor sales/revenue results to determine effectiveness of plans and suggest revisions to plans as necessary Utilize insights to assist Business Unit Executives and Strategy Marketing Management in determining trends and development in customer/member needs, competitive environment, identifying changes in market conditions, related industry needs and trends to include competitive positioning of products and/or services  Leverage member and prospect segmentation to help drive strategies that align business objectives with consumer wants and needs Monitor changes in the market conditions that require adjustment of both marketing strategic and tactical plans. Keep Business Unit executives abreast of changing conditions and recommend adjustments to marketing plans Develop and execute marketing campaigns using analytical and creative strategy that yields positive return on investment  Assist in the design of 1 and 3 year marketing strategic plans Manage internal marketing website content for front-line associates using Druple software | ||||
|
|
||||
|
US FL Tampa |
ADVERTISING/MARKETING REPS - Entry Level Position |
PSS, Inc. | 7/20 | |
| Details: PROSOURCE SERVICES, Inc.  NEW Careers Just Beginning!      ABOUT US: We are a marketing firm that specializes in sales and promotions for some of the most exciting and well-known companies in the world today. Our direct methods are capable of reaching 90%-99% of our client's specific target market and are personal, powerful and provide an upstanding image in the marketplace. With the commitment we've made to our clients and the use of our direct methods, it continues to lead us in only one direction: towards growth and expansion.WHAT THIS MEANS FOR YOU: We are rapidly expanding! We are currently welcoming individuals with little or no marketing or advertising experience to join our company. We have exciting positions for anyone who wants to get his or her "foot-in-the-door" in the world of business and have excellent "ground floor" positions for individuals who want to grow quickly to a position of GENERAL MANAGEMENT. Qualified candidates will be trained in the areas of: Sales, Promotional Marketing and Campaign Management.   TO APPLY: All openings are FULL-TIME and need to be filled A.S.A.P.!! There is no experience necessary. If you are a new graduate, or someone who is aggressively pursuing a change in careers, please contact Jackie Barnes to set up an immediate interview. You can e-mail (NO ATTACHMENTS) your resume to: for immediate review. | ||||
|
|
||||
|
US FL Tampa |
SAS Marketing Data Analyst |
Veredus | 7/20 | |
| Details: Why Veredus?Work with the best:ï‚· Best Places to Work in the State of Florida and in Atlanta ï‚· One of the Fastest Growing Staffing firms for the past 3 years in a rowï‚· FAST 50 Winner for the past 4 years in a rowï‚· Inc. 500 / 5000 WinnerThe Veredus Process:With the average recruiter possessing 8 years of staffing experience, Veredus can provide personal services from assistance with your resume and interviewing skills, to background information on the companies you will interview with, and more. You can also subscribe to the Veredus Job Blog to be informed of the hottest jobs through our Tweets and RSS feeds. Additionally, Veredus provides the following Benefits:ï‚· Virtually Free Health Benefits for Single Coverageï‚· United Healthcare Medical Benefits to All Consultants - no waiting period ï‚· Dental Coverage ï‚· United Healthcare Vision ï‚· Life Insurance (20k) ï‚· 401K ï‚· ATOP-Accrued Time Off Program ï‚· Consultant Lunches and Outings ï‚· Dedicated Consulting Services Representative (In addition to your Recruiter) ï‚· Consultant Web-Siteï‚· Consultant Discount Club Business Cards ï‚· Name Plates Care packages/Survival packs | ||||
|
|
||||
|
US FL Saint Petersburg |
Marketing Representative |
7/20 | ||
| Details: Marketing Representative  Part-time Marketing Representative needed for a medical imaging office in the St. Petersburg, Florida area. | ||||
|
|
||||
|
US FL Tarpon Springs |
Admissions/Marketing Registered Nurse for LTC!! |
Signature HealthCARE, LLC | 7/19 | |
| Details: Are you seeking a company that is REVOLUTIONIZING the long term care industry? If so, Signature HealthCARE LLC. is the place for you! Signature is opposing the status quo and bringing about a radical transformation in attitude, quality care and quality of life. We are taking a stand and restoring dignity, compassion and trust. We are currently recruiting for a proven and experienced nursing professional for our Tarpon Springs, Florida location for the position of Admissions/Marketing RN (Clinical Liaison)!The RN in this role would be responsible for marketing to the community and referral sources, completing patient admissions. We are looking for a Registered Nurse with experience in developing/implementing marketing plan; and a good understanding of LTC admission process including the referral process and pre-admission assessments.  We have competitive salaries in long term care based upon experience and good benefits including - Company paid employee medical coverage, company paid employee short-term disability, company paid employee life insurance, dental/vision Insurance, long-term disability, tuition reimbursement, employee referral bonus program, 401K with a company match, paid time off (PTO) and so much more!! Our Mission We are founded on the belief that enhancing the quality of life for the aging of America is essential. Humanity and dignity are achievable, and the nation’s elderly population deserves the attention and commitment of dedicated, compassionate care providers. Our Vision Statement We want a revolution that will radically change the long-term care landscape forever. The Revolution We find ourselves in a time in which there are many hurdles to overcome to simply stay in business, much less to accomplish our goal of unsurpassed resident care. If we choose the path of least resistance, we shall surely meet the same demise as many of our peers and predecessors. Society has systems in place that can work to our disadvantage, and there are those whose purpose is to see us fail. We must face these adversities with resolve, we must overcome obstacles with creativity; we must make our decision with our hearts as well as our minds. Perseverance is required if we are to win the battle of restoring dignity and profitability to the honorable service of caring for others. Signature HealthCARE’s revolutionary programs and services include:ο  Spirituality - Each resident and employee has the freedom to practice their beliefs in a faith-based, non-denominational environment. Signature HealthCARE embraces a Chaplaincy program, prayer chains and employee response system to support our divine purpose. The spiritual needs of each resident, their family and employee will be respected.ο Quality of Life – Provides resident choice, independence and a lifetime journey of active aging. Residents are encouraged to achieve their dreams which may include white water raftÂing, sky diving and helicopter rides, or something as simple as fishing and enjoying a picnic.ο  Resident-Centered Care - Each facility customizes the nursing care for each resident, to provide high quality care, utilizing a team-based clinical pathways focus.ο Agency-Free Staffing – Signature HealthCARE nursing and rehabilitation professionals are not temporary contractors. They are stakeholders wearing one uniform with one goal of delivering quality care and improved medical outcomes.ο  Uncommon Rehabilitation Outcomes – Last year, nearly 4,000 of our residents reÂturned home to enjoy their families, after receiving therapy in a Signature HealthCARE facility, thanks to the dedication of Speech, Occupational and Physical Therapy stakeholders!ο  Hall of Fame Café - Is a moving tribute that celebrates, honors, and recognizes the lives and legacies of those residents who have distinguished themselves during their lifetime. The Hall of Fame Café ensures that we will never forget...and that they will never be forgotten.Care RedefinedPlease call or email me with any questions you may have.  I look forward to hearing from you soon!                                                                    Lily Valdivieso Clinical Recruiter -Signature Consulting Services, LLC    877-734-3480 TOLL FREE  561.734.3481    - FAX EOE WE DO NOT UTILIZE OUTSIDE AGENCY for STAFFING!!! | ||||
|
|
||||
|
US FL Tampa |
Field Marketing Representative |
US Remodelers | $36,000 - $42,000/Year | 7/19 |
| Details: Field Marketing Representative U.S Remodelers, Inc. manufactures or procures, designs, sells and installs custom quality specialty home improvement products. The company’s home improvement products are exclusively marketed directly to consumers through the nationally recognized brand of a fortune 500 Home Improvement company.  Right now we are looking to hire self-motivated, goal-oriented individual to join our Field Marketing Program.ESSENTIAL DUTIES AND RESPONSIBILITIES -Maintains positive working relationships with retail staff;-Drives personal vehicle to/from all retail locations within specified territory;-Works closely with retail associates to generate cabinet refacing, bathtub liner and home organization appointments;-Work and schedule staff to work all assigned home shows and store events;-Regularly visits assigned stores to provide training, promotional materials, and reports;-Coordinates all home show and in store display logistics with the branch Installation Manager;-Installs and maintains in store signage and promotional materials;- Ongoing Maintenance and cleaning of displays as necessary;  WHAT YOU CAN EXPECT FROM US Medical & Dental Insurance 401K Retirement Plan Car AllowanceCompany PhoneMonthly Bonus Program Growth Potential Training and Development WHAT WE EXPECT FROM YOU Ability to Build and Maintain Business Relationships High Energy High School diploma or G.E.D. with some college or technical school training preferred. Must have clean driving record and carry automobile insurance limits that meet company standards Self Disciplined and Honest If you are looking for a secure and stable job with a reliable company, APPLY TODAY! | ||||
|
|
||||
|
US FL Tampa |
Customer Service / Entry Management / Marketing |
RAPTURE EVENTS | 7/18 | |
| Details: CUSTOMER SERVICE -MANAGEMENT-- FULL TRAINING       At Rapture Events we have a positive team oriented environment filled with both successful and competitive individuals. They are not only looking to build their individual careers, but are focused on the future success and growth of both our clients and consumers. Every member of Rapture is motivated, hard working and is given a game plan for success and growth. We enjoy what we do and who we work with. We provide full hands on training to insure success, quality, and growth for our team as well as our local and national clients. Customer Service and Entry Level Management Positions  IMMEDIATE HIRE  RAPTURE is a young and aggressive marketing and advertising firm that works with national and local clients in the sports, entertainment, and restaurant industries. RAPTURE is currently looking to fill 12 full time customer service positions.  THIS IS NOT TELEMARKETING!! WE ARE NOT PHONE JUNKIES!  The customer service positions are entry level, and the customer service representatives will have full training. RAPTURE is also looking to train 8 new entry level management positions. With our client portfolio expanding so rapidly, RAPTURE is looking to train the right candidates to help run our branch offices. There is no experience necessary, paid training is available. NO GRAPHIC DESIGN, NO DATA ENTRY OR TELEMARKETING Email your resume as part of the text. NO ATTACHMENTS PLEASE! | ||||
|
|
||||
|
US FL Tampa |
Sports Marketing and Customer Service Positions Availabe |
Clear Point Marketing | 7/17 | |
| Details: SALES AND CUSTOMER SERVICE REPS - Entry Level Marketing and AdvertisingDo you enjoy working with people?...Seek opportunity beyond what has been made available to you?...Have ambition and desire?...Know that you are ready for the NEXT STEP in your career?Then Clear Point Marketing what you are looking for!We are experiencing unprecedented growth and need a few great individuals to help us further reach our goals collectively. We develop and execute print based promotional ad campaigns for our clients in the sports and entertainment industry. We are in a unique situation where we have more clients than we can actually handle and are looking for career oriented individuals to run some of our accounts.We are seeking team players to conduct all facets of the advertising, sales and marketing we do for our clients. Position involves face to face promotional marketing and sales presentations to new customers, territory and demo-graphical research. | ||||
|
|
||||
|
US FL Town 'n' Country, Carrolwood, Northdale |
MARKETING / ADVERTISING - All Positions Available |
PROSOURCE SERVICES | 7/16 | |
| Details: ONE WEEK HIRING EVENT!! 20 POSITIONS NEED TO BE FILLED ASAP!With our recent expansion, and more to come over the next few months, we currently need to fill 20 immediate entry level positions to help service our growing client base. These openings are essential to the success of our company, as they will be the future leaders of our company. We are looking to train the right candidates as soon as possible!  NO EXPERIENCE IS NECESSARY!! If you’re looking to get into a NEW CAREER or just an individual looking for a career change, then please apply!   CONTACT US: INTERVIEWS ARE BEGINNING THIS WEEK! Please contact Chris James at 727-216-6393 to set up an immediate interview with our hiring manager. Or, you may submit your resume to for immediate review. | ||||
|
|
||||
|
US FL Bradenton/Sarasota |
Marketing Associate |
ITW Military GSE | $35,000 - $40,000/Year | 7/16 |
| Details: Attention to detail must be a strength Ability to organize, document, and track work as well as report status to management Good communication skills to include phone, written, etc. Good computer skills to include Microsoft Office applications Ability to work at a fast paced work environment Proficient in managing various customer accounts and projects which includes:Â time management, leadership, team building, project milestones, and sales and operation planning. Familiarization with AS9100/ISO 9000 Quality requirements a plus Once the candidates are selected for the final round of interviews; each candidate will be required to conduct a 20 minute presentation on the topic of their choice in front of the management staff. | ||||
|
|
||||
|
US FL Bradenton |
marketing sales COORDINATOR |
Bradenton Herald | 7/16 | |
| Details: Marketing Sales Coordinator Join our energetic team!  The Bradenton Herald Circulation Division is seeking a Marketing Sales Coordinator responsible for improving circulation. The right person will analyze sales pressure and marketing information on a regular basis and then work closely with independent sales contractors and the Community Relations Manager to develop and implement growth programs. This position also works in the field, developing business partnerships within the community to build newspaper circulation.  Further duties include: • Manage sales and retention programs aimed at driving home delivery and single copy (outlet) sales• Attend and manage select marketing sales and community events• Develop new sales opportunities and build strong partnerships with new and existing retailers and customers. • Provide assistance to walk in customers at the circulation counter to answer questions, provide directions and problem solve. • Provides front desk and switchboard relief coverage.Applicants should have a minimum of two years sales experience, marketing or supervisory experience. Prior newspaper experience will be considered a plus.  Must have a reliable vehicle, a valid Fla. driver’s license and automobile insurance. Benefits include medical, dental, life plans, 401(k) plan and competitive base salary. Please e-mail your resume to    Equal Opportunity EmployerDrug Free Environment | ||||
|
|
||||
|
US FL Saint Petersburg |
Director of Admissions & Marketing |
Boca Ciega Center | 7/14 | |
| Details: Boca Ciega Center, an 120-bed skilled nursing and rehabilitation facility, is seeking a full-time, experienced Director of Admissions & Marketing.   The position requires an individual that thrives in a fast-paced, healthcare environment. The DOA is accountable for the overall admissions process for the facility, including identifying and developing new and viable admission sources and referrals, and leads the marketing efforts of the facility in terms of building strong community and hospital relationships. | ||||
|
|
||||
|
US FL West Tampa Bay area |
APPLY TODAY, START TOMORROW! Marketing, Sales Reps |
Pro Source Services, Inc. | 7/13 | |
| Details: ABOUT US:Pro Source Services, Inc. is one of Tampa's most progressive marketing firms with an exceptional track record of satisfied clients and customers. We hold an amazing portfolio of Fortune 500 companies including National Retailers as well as companies from the Home Improvement Industries. With our recent expansion, and more to come over the next few months, we currently need to fill 15 immediate entry level positions to help service our growing client base. We are looking to train the right candidates as soon as possible! Candidates hired will learn the following:  Event Marketing, Event Management, Promotional Sales, Lead Generation. NO EXPERIENCE IS NECESSARY!! If you’re looking to get into a NEW CAREER or just an individual looking for a career change, then please apply!    CONTACT US:INTERVIEWS ARE BEGINNING THIS WEEK! Please submit your resume to for immediate review. We will contact candidates immediately for interviews. | ||||
|
|
||||
|
US FL Tampa |
Customer Service / Retail Events-FULL TRAINING IN MARKETING |
SOUTH SIDE INC | 7/13 | |
| Details: CUSTOMER SERVICE / RETAIL EVENTS-FULL TRAINING IN MARKETING     South Side Associates, Inc., a NEW Event/Retail Marketing Firm, is looking to fill 5 full time positions for Brand Representative.   Our Brand Representatives execute retail marketing programs in major retail facilities throughout the Tampa metro areas. This includes:  - setting up event kiosks- handling supplies, inventory, and samples- demonstrating product- customer service;- basic sales and promotions- maintaining relationships with our retail partners Full training, classroom style and hands-on, will be provided for all new employees.  
 The ideal applicant will have some prior experience working with the public. Retail, sales, or marketing experience preferred but not required. Must be outgoing and be able to communicate and present yourself professionally.  EXPERIENCE IN THE FOLLOWING AREAS WILL HELP YOU ADVANCE QUICKLY IN OUR COMPANYMARKETINGADVERTISINGRETAILCUSTOMER SERVICEEVENTSSALES | ||||
|
|
||||
|
US FL Tampa |
Beverage Marketing Manager |
TEAM Enterprises | 7/12 | |
| Details: TEAM Enterprises is an event and promotional marketing company who is looking for an Activation Manager (AM) in Tampa, FL. The AM is specifically accountable for the overall results in their assigned territory for sales volume, distribution, promotion execution, and key retail and client relationships. This is an exciting opportunity to work with a successful client and help continue their growth in the United States. The prospect for career development and growth is great with several avenues open to high achievers.People Development Skills: Recruit, hire and train quality promotional staff who are knowledgeable about the client’s products and portfolio Recruit, hire and train effective team leaders when required to implement multiple brand promotions during key holiday periods, and for short and long term special events Train promotional staff to implement experiential promotions and speak to the consumer about brand attributes Provide regular feedback and clear direction on all expectations and tasks to promotional staff to evaluate effectiveness and continuously improve execution Motivate promotional staff to maintain a good attitude and leave a positive impression on consumers Provide strong leadership skills to develop personnel and continuously educate them on the importance of execution activities Ensure promotional staff meets all client’s objectives Deal with any performance issues in a timely manner within TEAM policies and procedures, acting with a sense of urgencyClient Relationship Responsibilities: Be the local point of contact for client personnel Ensure TEAM Enterprises’ objectives align with local client objectives Manage conflicting demand requirements between the local and national client, and TEAM Maintain regular contact and communication between client field personnel and TEAM Enterprises Meet with client regularly to keep up to date on product and industry knowledge Gather and report all competitive activity to client and TEAM Management Always sell TEAM’s values to the client and uncover additional opportunities for TEAM to serve the client Ensure clear and open lines of communication; track, measure and communicate all progress on National and local events to ensure client’s goals are met and exceeded Work with sales representative in the field a minimum of once per week to assist them in selling the client’s brands and programs to targeted accounts Attend monthly sales meetings at the distributor and any other special meeting requests Work with distributor personnel to identify key industry driver accounts and key traffic periods in the accountsField Execution Responsibilities: Knowledgeable of all client brands required Consistently achieve and exceed assigned promotion events and consumer interactions both on and off-premise Utilize strong selling skills to increase distribution and brand visibility in assigned accounts Merchandise all new placements with POS and regularly conduct wait staff training Utilize strong selling skills to sell in event promotions to retail on key nights to maximize brand visibility, sales opportunities, and product features Ensure promotional staff conduct promotions to TEAM’s quality standards Execute all local market area special event requests Work with promotional staff at all events Recap all promotions and evaluate the effectiveness Complete a pre-plan before calling on accounts and a daily call activity report for all account calls Develop a monthly promotion plan schedule to ensure all accounts are visited with the proper frequency Develop and maintain a positive working relationship with 60 to 80 targeted accounts Call on all targeted accounts a minimum of twice per month Provide local marketing promotional calendar to all appropriate client personnel on a weekly basisAdministrative Responsibilities: Complete all administrative responsibilities in a timely and accurate manner Maintain proper records for all expense reports and ensure they are completed on time with all receipts attached Maintain electronic tracking of promo staff and events scheduled and completed on a daily basis Maintain promotional staff files with proper signed paperwork to include W-9, Contractor Agreement and a copy of a valid driver’s license Ensure that no promotional contractors work for TEAM prior to all paperwork being completed and sent to corporate Responsibly manage all assigned company and client equipment and assets to protect from damage and theft, as well as provide proper packaging and shipping guidelines Manage all informational requests and recap key takeaways to TEAM Management | ||||
|
|
||||
|
US FL Seminole |
Marketing Specialist |
Superior Uniform Group, Inc. | $37,000 - $41,000/Year | 7/12 |
| Details: This position will assist in developing and executing all marketing strategies and activities to include social media and development of content for the Company website. The position will communicate and support both internal and external customers, and work with industry and media contacts. Responsibilities:  Plans and works with Marketing Communication to implement all catalogs, advertising and promotional activities for their Market(s).  Assists with establishing marketing goals to ensure share of market and profitability of products and services provided. Helps develop and implement the Market Plans and programs, both long and short term to ensure the profit and sales growth. Creates copy for and works with graphics to communicate and execute appropriate messaging. Reviews proofs for consistency and accuracy and provide suggestions for enhancement.  Researches, analyzes, and monitors changes in market conditions, competitors, suppliers, so that market opportunities can be capitalized on and the effects of competitive activity be minimized. Participates in marketing planning and brainstorming meetings. Prepare summary of action items as required.  Researches and negotiate advertising opportunities. Request and maintain library of media kits and contact lists.  Writes, edits and distributes press releases. Maintains media contact list and updates as necessary.  Collects the appropriate information, including project specifications, from both external and internal stakeholders and creates compelling marketing copy for fliers, brochures, e-mail blasts, catalogs and more.  Writes and updates website copy and images as need.  Researches social media and SEO strategy and trends.  Suggests and writes content for and prepares e-mail blasts in Constant Contact or equivalent e-mail marketing software. Maintains and monitors list quality to include bounce-backs, leads and more. Assembles marketing promotions and direct mail packages. Duties may include ordering components, creating and printing letters, assembly and shipping. Maintain marketing campaign calendar. Schedules meetings as necessary.      Researches and estimate project costs, to include printing, shipping and more.  Assists in developing and working with the Sales Organization for selected Sales Presentations and supporting Materials | ||||
|
|
||||
|
US FL Tampa |
Marketing Database Specialist |
WellCare Health Plans Inc. | 7/12 | |
| Details: Contributes to the flawless execution of the WellCare marketing process. Provides data management support for direct marketing activities that collectively bring WellCare's marketing strategy to life. Collaborates with marketing operations leaders and analysts to implement a targeting strategy that reduces customer acquisition costs and has a measurable impact on company results.  Essential Functions: Oversees the creation of campaigns and their associated codes for marketing attribution (SalesForce.com) Creates and executes prospect list pulls for direct mail and Teleservice. Performs quality assurance of list pulls. Accountable for the delivery of files to vendors and data partners. Validates integration of scheduled file updates in databases. Collaborates with analysts and marketing ops team to optimize targeting methods. Develops and delivers concise, precise and graphically pleasing marketing scoreboards and presentations to articulate progress against business-driving goals. Identifies business process gaps that put data integrity at risk and proposes solutions. Builds internal relationships to leverage common database marketing tools/processes. Proactively identifies operational issues and proposes solutions to management. Recommends improvements to WellCare marketing applications, including documentation of the business case &/or business requirements. Influences on-going targeting strategy and calendar planning based on past results. Performs other duties as assigned. | ||||
|
|
||||
|
US FL Tampa |
Marketing Team Leader |
Whole Foods Market | $18.50 - $27.00/Hour | 7/12 |
| Details: The Florida Region is searching for a Marketing Team Leader. This position will support store and regional leadership in the creation of marketing strategies and quarterly marketing plan designed to meet or exceed store and individual department sales goals, desired customer count and basket size targets. Will assume responsibility for store’s execution of all national and regional marketing programs, and will oversee store artists(s), demo team and other marketing team members to achieve these goals. Responsibilities·        Fully implement and support all national marketing programs and initiatives.·        Develop marketing strategy for store to achieve store-specific objectives.·        Write and distribute press releases to promote awareness of store events, strategic partnerships and external event sponsorships.·        Manage store marketing and donations budgets.·        Develop mutually beneficial promotional relationships with local schools, businesses and community organizations.·        Serve as advocate and information source in the store for regional marketing programs and graphic standards.·        Educate Store Leadership and Team Member base on regional marketing initiatives.·        Develop and execute in-store events to increase sales, inspire customer loyalty, and enhance store theater and customer experience.·        Serve as liaison to community by promoting and executing community 5% days and managing store’s donation program by ensuring that receiving organizations fit closely with Whole Foods Market core values.·        Act as store’s liaison to all neighborhood associations, civic associations, like-minded activist organizations and charities.·        Organize and conduct store tours as necessary.·        Manage Store Graphic Artist, Store Demo Team, Lifestyle Center Specialist, Store Concierge and Catering Team Member, while working closely with their regional reports, if any, to ensure that they remain in focus with both store and regional marketing initiatives.·        Develop and implement external marketing and advertising programs.·        Research competition and local community, summarizing findings for store and regional leadership as necessary.·        Perform other duties as assigned by the Store Team Leaders or Regional Marketing Leadership. | ||||
|
|
||||
|
US Nationwide |
Sales and Marketing Director / Palm Springs, CA |
Gannett Co., Inc. | 7/10 | |
| Details: This position is located in Palm Springs, CA and relocation would be required to that area.The Desert Sun, in Palm Springs, CA is seeking an innovative strategic thinker to drive revenue by overseeing and executing sales and marketing strategies. This position will drive and grow revenue by identifying opportunities, analyzing competition, developing new products and services, applying best business practices, communicating with businesses, generating leads, and supporting sales. This position will be accountable for establishing and enhancing the media company’s brand, and maximizing advertising revenue and improving the organization's competitive position and its penetration of target markets. Drives revenue by developing and executing effective sales strategies, identifying growth opportunities in the marketplace and setting pricing. Directs all advertising functions across all platforms and all business development and marketing functions. Develops strategies to maximize sales resources and optimize revenue development including multi-platform product positioning and pricing for clients of all sizes. Ensures advertising and marketing meets the needs of businesses and enables them to grow their businesses. Meets with advertisers and potential advertisers regularly and develops strong relationships. Develops high-quality, customized presentations to targeted clients and segments to secure new revenue and grow existing relationships. Analyzes business performance (active accounts, churned business, pricing, advertiser packages, etc.) and adjusts strategies and initiatives to achieve revenue goals. Develops and executes the Desert Sun’s B2B strategy and increases brand awareness to improve positioning of the Desert Sun in the Palm Springs media market. Analyzes marketplace and competition to determine most effective pricing and sales strategies. Analyzes market conditions. Provides strategic digital sales direction for the company. Supports multi-platform, new media and marketing initiatives. Prepares and implements the department’s operating budget, revenue and expense plans. | ||||
|
|
||||
|
US FL Tampa |
Director of Sales / Marketing |
HPH Hospice | 7/9 | |
| Details: HPH Hospice is a non-profit agency founded in 1982. It services the need of patients and families in Pasco, Hernando and Citrus counties who are affected by life-threatening illnesses. HPH Hospice offers medical, emotional, social and spiritual support services. We provide dignity, comfort, and care for patients through pain control and relief of symptoms. Provides choices for patients regarding care. Support patients and their families emotionally and spiritually. Offer grief counseling to help restore the emotional well-being of survivors.About the opportunityThe Sales / Marketing Director is responsible for developing and implementing a marketing program that enhances and expands referrals/admissions to agency programs (Hospice and Home Care).  Will lead and direct the work of all marketing related field staff. Job Responsibilities: Determines referral/admission objectives for agency programs. Develops marketing plan Leads and direct work of all marketing staff. Provides coaching on referral generation, developing new referral sources and strategies and sets measurable goals for staff. | ||||
|
|
||||